PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00031834-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 65aa    MW: 7502.69 Da    PI: 9.975
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00031834-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.81.4e-094331948
                        TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48
                         G g+W+ +ar  g+ R++k+c++rw +yl
  WALNUT_00031834-RA  4 NGQGCWSDVARNAGLQRCGKSCRLRWINYL 33
                        58889***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.38137IPR017930Myb domain
SuperFamilySSF466894.25E-15461IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-13436IPR009057Homeodomain-like
CDDcd001671.07E-4533No hitNo description
PfamPF139211.4E-7848No hitNo description
Gene3DG3DSA:1.10.10.604.9E-93760IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MLNNGQGCWS DVARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEALI IHLHSLLGNR  60
FFIPY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7112843e-58KP711284.1 Betula platyphylla MYB transcription factor 46 (MYB46) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211763.19e-39hypothetical protein PRUPE_ppa009566mg
RefseqXP_009376885.19e-39PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV25e-35MYB46_ARATH; Transcription factor MYB46
TrEMBLM5WGP81e-38M5WGP8_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s26590.11e-36(Populus trichocarpa)
STRINGGLYMA11G14200.22e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.14e-37myb domain protein 83